GenomeNet

>pao:Pat9b_1690 superoxide dismutase copper/zinc-binding protein; K04565 superoxide dismutase, Cu-Zn family [EC:1.15.1.1] (A)
MNRILIAVLALFCSGVAQAASEQVTLHKVTEQGIGAAIGKVTISETPWGLQFTPELSGLP
PGIHGFHVHAKGSCEPGESGGKMVAAGAAGGHLDPANTGKHLGPYANGHLGDLPALFVTD
EGKADYPVLAPRIKSLSEIKGKALMVHMGGDNHADHPQPLGGGGARFACGVI

BLAST