GenomeNet

>pap:PSPA7_3173 ligD; ATP-dependent DNA ligase; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MPSKPLAEYARKRDFRQTPEPSGRKRRKDGDGLLRYCIQKHDASRLHYDFRLELDGTLKS
WAVPKGPCLDPAVKRLAVQVEDHPLDYADFEGSIPKGHYGAGDVIVWDRGAWTPLDDPRE
GLEKGHLSFLLDGEKLSGRWHLIRTNLRGKQPQWFLVKSKDDEARSLDRFDVLKERPDSV
LSERTLVPRRGEAATPAARPARRGKAGKAGKGGGKTPMPEWIAPELASLVEQPPHGQWAY
ELKLDGYRLMSRIEDGHVRLLTRNGHDWSERLPHLKKALAGLGLERSWLDGELVVLDEEG
RPDFQALQNAFEEGHGENILYFLFDLPYHEGEDLRDVALEERRARLEALLDGQDEDPLRF
SATLAENPRDLLASACRLGLEGVIGKRLGSVYRSRRSNDWIKLKCQLRQEFVIVGYTEPK
GSRRHIGALLLGLYSPDEERRLRYAGKVGTGFTAASLKKVHERLAPLAINSSPLAKVPPA
RETGVVQWVRPERLCEVSYAQMTRGGIIRQAVFHGLREDKPAREVTGERPAGPPPARGAR
KAGSASGASRAATAGVRISHPRRLIDPSIQASKLELAEFHARYADLLLRDLRERPVSLVR
GPDGIGGELFFQKHAARLKIPGIVQLDPALDPGHPPLLQIRSAEALVGAVQMGSIEFHTW
NASLANLERPDRFVLDLDPDPALPWKRMLEATQLSLTLLDELGLRAFLKTSGGKGMHLLV
PLERRHGWDEVKAFAQAISQHLARLMPERFSAVSGPRNRVGRIFVDYLRNSRGASTVAAY
SVRAREGLPVSVPVFREELDSLQGANQWNLRSLPQRLDELAGDDPWADYAGTRQRLSAAM
RRQLGRG

BLAST