GenomeNet

>pav:TIA2EST22_05220 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) thymidine kinase (A)
MAELVFHTGPMDSGKSTLALQMDHAQSAHDRQGVRYAMHDRSGGARITSRIGLSVEAVEV
TDSLDLYQDIVSRLSRGGRIDYLICDEAQFYRTKQIDQLARVVDDLDIDVYCFGILADFR
TELFPGSKRLVELADRVVEPPVSPLCWCGRPATHNARIVDGKLVREGDQVGVGDIGGGSE
IHYEVLCRRHHRQGITGEISRATLSEQTLPFDGSRS

BLAST