GenomeNet

>pav:TIA2EST22_07825 K01186 sialidase-1 [EC:3.2.1.18] | (GenBank) BNR/Asp-box repeat protein (A)
MTLTTKLSALTIAGIMVVIGVPMVTQSAMASGRAPAPVAATTQPKLVTGDITSTDQSGTN
LFFGKKIVRNARGAIMKVDRTWPAAVPAPLPDVRADSSTRMLLGPVVDLAVNEHPAGVFY
RIPALATASNGDLLASYDLRPGSAGDAPNPNSIVQRRSRDNGRTWGPQTVIHAGTPGRRK
VGYSDPSYLVDPATGRILNFHVKSYDRGFATSEVGTDPDDRHVLHAEVSTSTDNGHTWTH
RDITREITPDPTTRTRFVASGQGIALLHGPHAGRLIAQMTVRNSVGQQAQSIYSDDHGIT
WHAGNPVGRMMDENKVVELSDGTLMLNSRDAARSGRRKVAYSQDGGLTWGPVKLVDDLID
PTNNAQIIRAYPNARAGSAKARILLFTNVRNATERVNGTLSVSCDDGRTWVSHQTYMPGE
VGYTTAAVQSDGALGVLWERDGIRYSTIPMGWLNSVCPLAPSGRPTSGKPTSGTSLPPTA
TPSGSLHGGASSRPTSLPHTGD

BLAST