GenomeNet

>pba:PSEBR_a1134 Conserved hypothetical protein; putative RNA-binding S4 domain-containing protein; K06182 23S rRNA pseudouridine2604 synthase [EC:5.4.99.21] (A)
MTDPIRLSKRLIELVGCSRREAELFIEGGWVTVDGEVIDEPQFKVTTQKVELDPEAKATA
PEPVTLLLNVPAGTDVDTAMASLGPQTLSEEHRFGKRPLKGHFLRLTASADLQANASGLL
VFTQDWKILRKLTADAAKIEQEYVVEVEGEMVAHGLNRLNHGLTYKGKELPAVKASWQNE
NRLRFAMKNPQPGVIALFCQAVGLKVVAIRRIRIGGVSIGKVPLGQWRYLSAKEKF

BLAST