GenomeNet

>pba:PSEBR_a2838 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) Putative DNA ligase (ATP) (A)
MSSKTLDDYNRMRNFAATPEPAAKRSRKSAKTAHALQFCIQKHDASRLHYDFRLELDGAL
KSWAVPKGPSLDPKAKRLAVHVEDHPLDYATFEGNIPEGHYGAGDVIVWDRGVWIPQDDP
HEAYEKGRLKFELQGEKLSGLWNLVRTHMPGKQEQWFLIKHQDQAARPESEYDVVQAEPN
SVLSDRTLVPKRRGKAAAAKAVKQPEKAVQAKSPRGAAKTTLSGAVAGPLPDTLKPELAT
LVESAPDGEWLYEIKFDGYRVMACIEHGDVRLLTRNGHDWTHKLPRQAEALAELGLESAW
LDGEMVVANDQGVPDFQALQNAFEAGSSGKIAYYLFDMPYLNGMDLRKVPVQERRAALAA
VLEPNESPLLRFSDAFEETPEALLNSACQMQMEGLIGKRIGSAYVSRRSNDWIKLKCKNR
QEFVVVGFSDPKGARSAFGALLLGLHDADSGQLRYAGKVGTGFNETTLKSIYQQLLPLET
KKAAVVNPPSGYEAKGVHWLEPTLLAEVAFAEMTKDGSVRHAVFHGLRNDKPAKDITQEL
VKPVKKTAAAKKTKAKHEPGATPAKTKSKAKAPALDGKVRITHPERVIDASSGTTKLQLA
EYYASVAEFILPELADRPVALVRAPDGIAGELFFQKNAERLAIPGITSLDKALTGQPVMI
INNAEALIGAVQMSTVELHTWNATSVDLDKPDRFVLDLDPDPALPWKSMVEATQLTLSVL
DELGLKAFLKTSGGKGIHVVVPLTRKLGWDEVKGFSHAIVSHMAKLLPDRFSAVSGPKNR
VGRIFIDYLRNGLGATTICAYAARTREGLPVSVPVFREEVAELKGANLWNVHNVHERLAE
VGHEPWAGLKRTRQSITAEMRRRIGMRETDK

BLAST