GenomeNet

>pbe:PB000119.02.0 K11428 histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43] | (RefSeq) hypothetical protein (A)
MQPMCGYRSNHIPLLIYDRYYFWSLHFLFEKSKVKRQRLNINTKLEIQDCINKYNIHDEL
DMYTSIYNSAYSKYENTKDSQLNGYELNKRRNENANKHDSRNGNMLNNDQIKYPYLNGLK
NNKNILEDNLNAINDVKWYRLKIKIEETGKKNKNQCFSYSSNNFKNKNTDKCNPKKSSNI
NSFYCLTNETENDNLNKLIKMQKKKTIVLNQNKVKTEDTENKSQIINNSSCNTQKNEQNG
NQEKPIIISDTYNHISTNNNAKRKKRKKRKTWYYCHSSSNDMADDNDEKPDSIVSSHKIY
IEKSSESNTGVNDGEHNEYFETDKYYRENNFNSSHSGQSKNNIYNANNEIDKLKCMNAGK
ELDSKNDNDNTSKKLEEMKNHCINIEDATIGNDTETQKEKNKQNLKTKNAYIEENRTNKS
INLNENTKLTLKSSKLYKLKSYEYIDYFKNMFYNNLENHQNKINHQIFKKNKFDKDCIDL
YINKILKNILDKKRPHLNSLSKSFERIETFYKKNYKIFIIDDKDFYTCDKKEHFKNQNYL
YELSDQKIKNDQNFEDNDIFNYFKKYIPTEHNAQKLTSKPQENYHTFQNEFIPTENVDIE
GQSYSNFKEGIPIKKKSKTEGNSLSKEDITETNHLIQNRISNEFNKDFNDQELKLEGISE
STEIVADADIIFVFISKKHKCLEKKLKQGDYIYIKFNDTCHSYDKVKILPKNIIIQILIY
LIKNTENIKLTTISTYSPDLLWNISLHFRKYIIDLDICFEKLYRFFSEKREQENENGGNK
EAKQRHADFSDSCIYYYGEPQNKKKDLEIMKLKDSVNFIDKFLQNINSRKIEKLKKSRIE
YYEKYEYDRTINKLNKQQLIDLFIDKEAEINIIPLSYLKEKSRNIIYEENLKMNMFACIK
VIFDSIKGRCIYADTQINKFDFVFEYVGELLTHNEAMEREQTYIKNKKKGCYMFYFKHEN
KRYCIDGTEESIDAAINYTNKKYFLRSFARLVNHSKKNSNLIPKVLTVDFLPRLFFIASR
DIQKGEELLIDYGERNREIIKDNEWLKL

BLAST