GenomeNet

>pbe:PB300681.00.0 K02358 elongation factor Tu | (RefSeq) hypothetical protein (A)
KIIVYLNKIDMCDDQELVDLVELEVRELLSFHKYDGDNIPFIKGSALKALNDDPSEYGVP
SILKLLDACDNYIDEPKRKIDLPFLMSIDDVLQISGKGTVATGRVEQGTIKINEPVDIIG
IKEKSIKTVITGIEMFRKTLDTAQAGDQIGIMLKNVKKNDISRGMVVTKVPNMKTYKKFE
SDIYVLKNEEGGRKNPFSSYYRPQVYIRTADVNCAVILNEDTQIANPGDNIKCTIELMYP
LAISSGLRFSLREGGKTVASGIITKVL

BLAST