GenomeNet

>pbe:PB300681.00.0 hypothetical protein; K02358 elongation factor Tu (A)
KIIVYLNKIDMCDDQELVDLVELEVRELLSFHKYDGDNIPFIKGSALKALNDDPSEYGVP
SILKLLDACDNYIDEPKRKIDLPFLMSIDDVLQISGKGTVATGRVEQGTIKINEPVDIIG
IKEKSIKTVITGIEMFRKTLDTAQAGDQIGIMLKNVKKNDISRGMVVTKVPNMKTYKKFE
SDIYVLKNEEGGRKNPFSSYYRPQVYIRTADVNCAVILNEDTQIANPGDNIKCTIELMYP
LAISSGLRFSLREGGKTVASGIITKVL

BLAST