GenomeNet

>pbl:PAAG_04238 succinate dehydrogenase flavoprotein subunit; K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] (A)
MFSQASMSMRRILAPTRHFPLAGKVDMHLSSTSYFPKHNDYTRKPSAGLDNQRLWKRSFT
STSGLYALQGVGQAKAVGLNHIQIIDHRYDALVVGAGGAGLMAAVGLAECGLETACISKL
FPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCKEAPKTVLEL
EGYGMPFSRTAEGKIYQRPIGGQSLKYGSGGQAYRTACAADRTGHAMLHALYGQSLKHDC
KFFIEFFALDLMMVDGRCVGVTALDMETGTLHRLFSRNTIIATGGYGRAYFSCTSAHTST
GDGCAMASRAGLPLQDMEFVQFHPSGIYSAGVLITEGARGEGGYLLNSEGERFMERYAPT
AKDLASRDVVARSMNMEIREGRGVGPDKDHIYLQLSHLPKELILERLPGIAETASIFAGI
DITRQPIPVLPTVHYCMGGIPTNYKGQVLNVDLATGKETPVPGLYAAGEAACVSVHGANR
LGANSLLDIAVFGRASAAHIAENNEKGMLHSSVPRDIGMPSFEDMERLRTSDGRKLTAEL
RLDMQKAMQSDVAVFRAEDSLTSGVSKVQQVEHSFRHDVCVKDKSLIWNSDLIETLEMRN
LLTCAAQTAKSALDRKESRGSHAREDFPDRDDVQFLKHSLSWQTEETEPVKVGYRDVIFA
TLDETDCPSVAPKKRTY

BLAST