GenomeNet

>pcb:PCHAS_100250 K11428 histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43] | (RefSeq) PC000925.02.0; SET domain protein, putative (EC:2.1.1.43) (A)
MKKTKTNTTFESSKHTDNDTFENNNSSFKDLVSIIWIEKEKLDSIVHIPLYADLSKYFDD
LNKNPINQGNDTSIISKVYLLFDDDSCNIALDISPICGYRNNHIPLLIYDRYYFWSLHFL
FEKSKVKRQRLNINTKLGIQDCINKYNIYDELDMYTSIYNSAYKKYENTKGNQLNGYELN
KRRNENTNKHDSKNGNILNNDQIKYSHLNGLKNNNNILENNSNSINEAKWYRLKIKIEEA
GKKNKNQSFSYSTNNVKNKNADKCNQKKSSNINNFSCLTNEKENANLNKLIKMQKKKTVL
NQNKVKTEDTENKSQIINNSSCNTQKNEKNGNEEKPIVISDTDNNIPTNNSAKRKKRKTW
YYCHSSSNDMTDDDDGKDDSIVTSHENSTEGNTGVKDGEHNEYFETDKHCRENNFNRSHV
GQSQNNIHDEKNTIDKLKYKDFGKEIDNKNANNNSSTKLEGMENHCINIEDTSIENDTEI
KKENEQYLKTKNISIEENSTNKPINLNDNTKLILESSKLYKLENYEYVNCFKNMFYNNLE
DQQNKINHHIFKKNKFGKDCIDLYINKILKNILDKKKPHLNSLSKSFERIETFYKKNYKI
FIIDDEDFYTCDKKEHFKNQNYLYELSEQKIKNDVQNFEDNDIFNYFKKYIPTERDAQKL
TSKPQDNCHTFQDECIATENGDIKGQSYSNSKEGIATKEKCETEGNALSKEGTTDTNHLP
PNNLSTEFKKDCNDQNLKLEDISESTEIDTDADIIFTFISKKDKCLEKKLKQGDYIYVKF
NDACHSYDKVKILPKKIIIQILIYLIKNTENIKLTTISTYSPDLLWNISLHFRKYIIDLD
MCFEKLYKFFSEKREQENENDGKQEVKQRLVDFSDSCAPYYEKSQNKKQDIEIMKLKDSV
NFIDKFLQNVNSRKIEKLKKARIEYYEKYEYDRTINKLNKQQLIDLFIDKEAEINIIPLS
YLKEKSRNIIYEENLKMNMFACIKVIFDSTKGRCIYADAQINKFDFVFEYVGELLTHNEA
MEREQTYIKNKKKGCYMFYFKHENKRYCIDGTEESIDAAINYANKKYFLRSFARLVNHSK
KNSNLIPKVLTVDLIPRLFFIASRDIQKGEELLIDYGERDREIIKDNEWLKL

BLAST