GenomeNet

>pcb:PC000925.02.0 hypothetical protein; K11428 histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43] (A)
IQDCINKYNIYDELDMYTSIYNSAYKKYENTKGNQLNGYELNKRRNENTNKHDSKNGNIL
NNDQIKYSHLNGLKNNNNILENNSNSINEAKWYRLKIKIEEAGKKNKNQSFSYSTNNVKN
KNADKCNQKKSSNINNFSCLTNEKENANLNKLIKMQKKKTVLNQNKVKTEDTENKSQIIN
NSSCNTQKNEKNGNEEKPIVISDTDNNIPTNNSAKRKKRKTWYYCHSSSNDMTDDDDGKD
DSIVTSHENSTEGNTGVKDGEHNEYFETDKHCRENNFNRSHVGQSQNNIHDEKNTIDKLK
YKDFGKEIDNKNANNNSSTKLEGMENHCINIEDTSIENDTEIKKENEQYLKTKNISIEEN
STNKPINLNDNTKLILESSKLYKLENYEYVNCFKNMFYNNLEDQQNKINHHIFKKNKFGK
DCIDLYINKILKNILDKKKPHLNSLSKSFERIETFYKKNYKIFIIDDEDFYTCDKKEHFK
NQNYLYELSEQKIKNDVQNFEDNDIFNYFKKYIPTERDAQKLTSKPQDNCHTFQDECIAT
ENGDIKGQSYSNSKEGIATKEKCETEGNALSKEGTTDTNHLPPNNLSTEFKKDCNDQNLK
LEDISESTEIDTDADIIFTFISKKDKCLEKKLKQGDYIYVKFNDACHSYDKVKILPKKII
IQILIYLIKNTENIKLTTISTYSPDLLWNISLHFRKYIIDLDMCFEKLYKFFSEKREQEN
ENDGKQEVKQRLVDFSDSCAPYYEKSQNKKQDIEIMKLKDSVNFIDKFLQNVNSRKIEKL
KKARIEYYEKYEYDRTINKLNKQQLIDLFIDKEAEINIIPLSYLKEKSRNXIYEENLKMN
MFACIKVIFDSTKGRCIYADAQINKFDFVFEYVGELLTHNEAMEREQTYIKNKKKGCYMF
YFKHENKRYCIDGTEESIDAAINYANKKYFLRSFARLVNHSKKNSNLIPKVLTVDLIPRL
FFIASRDIQKGEELLIDYGERDREIIKDNEWLKL

BLAST