GenomeNet

>pcl:Pcal_2050 K00170 pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1] | (GenBank) pyruvate ferredoxin oxidoreductase, beta subunit (A)
MAEEYAGLYEYANFELPQEELFLPGHGLCASCTIGVIARHMLKVLGPDTVVVNPTGCAEV
STVVYPRTNWAVPWMHVAFGNGGSVASGIEAAIKALKRRGVIDPNRKINVVVFAGDGGTA
DIGFQALSGMLERGHRVIYIMYDNEGYMNTGIQRSGTTPLGASTTTAPAGRKVPGNVTHK
KPMALIAAAHGIPYVATANPAYVHDMVMKIKKAAEVDGPSFIHILQSCTPGWRFEPKYAI
RVLELATETGYWVNYEIENGEFRVTIPVPKRKPVKCFLQLQGRFKHLKPEEIDMIQAIID
RDVAEINRMVGREVIGPVDPSLPCMTPRGAK

BLAST