GenomeNet

>pdx:Psed_2901 DNA polymerase LigD, polymerase domain-containing protein (A)
MAAKTVVQLTVPGPEGDREVRLSSPDKVYFPARGITKRQVVEYYLAVSEPMTRVLLNRPT
NLKRFPDGVDGEPFFAKRLPKGAPPWVRTATVTFPSGRKADTLAPSEPAVIAWAANLGTL
DFHPWPVRAADTDRPDELRIDLDPQPGTDFADAVAVAAVLREVLDEAGLVGWPKTSGGRG
IHVFARIRPEWSFIEVRRAVIAIARRVCARIPEQATVDWWKEERGERVFLDYNQAARDRT
IASAWSVRGLPRATVSMPLTWEALPSVEPEDFDLLTVPGLLARDGDPHAGMDDAVGGIET
ALEWFAADERDRGLGELPYPPEYPKMPGEPMRVQPSRARAGKDAAG

BLAST