GenomeNet

>pfa:PFD0190w SET domain protein, putative; K11428 histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43] (A)
MKSMTLYHENFKNINSFLNSASVIWIEKEKLDSIIYIPLYTDIFQYVENFIKNTEKKEKK
NVLTKIYLLFDDDTYNIAVDISPLCNEHTNRIPLLIYESYHFWHLQFLFEKFKIKRQKLI
LNPFENLKDIINKNRTYDYVYMYTSIYNCANNNFERQSKGEKIIQNHNEEITQEINQKVI
TKYCTYRNNFSTHLSLLNYNFKDNNNLYNDSNIKNKEPNWCPLKINIENIQKKRFKKINK
NKKHKNSKILNNTNMVHTLNSYVIPSNHFEKDDTKNKNLCIISQKEGNLHFQPYNGELKK
MKPLVYEEYEIISTDNDSNTLECGKKHENYNTSYDNYMYCTTNRCGRSPRYEGSKKSYAE
NNSRVYNRPHRKRKEKKKKWYYYEDSSSNDKNYNNNKKDDEEEEEENNDDKEENNDDKEE
NNDDEEEENNNNNNNSNKCDSLLTLDESFNNKKRKTSTCSTYSYNHMKKYKVEELKTDEC
NYDENYYNNTNNNNCYPLKEIYNYKYSEQMCNKFKKERIHTYDTFENKKGEKKNSVKNRK
ILHSSILSLDSQKMNPFDPIHTFKNMFCKSEKENLDFNHSDMFHIYHHNDSMDKYVNKIL
KNIMNKEKSPLNCLSKNYQRIEALYNKKYKIFLMDNKQIINGKTHFKNNKNEYILSKYEK
EMGLYELFKKYIKRDVEKVHNEKGQPQKPSNQNIERIHNSTEKHILQIQKRQEHSCVTEL
VGMCNIKEQDIINVKSCDDDDIICLSDEKNYMQEENDVICIDDNNNNNIYNDNNYNDNNY
NDNIYNNNIYNDNNYNDNIYNDNNIIDRHNNGGVLFYAYKKEDTKVIKLKEGDSLYIKFF
NSSDDYDKVKILKQETILFILIYIMQNKETPTLSDICIFSPDLFWNICLYFKDNIMGVDP
SLVKIHKFLSTGKSEENGYHRYSSKRINYCEKRKKRKNREPMEIMKLKDNVEFLDKFLEN
VNERKLNKLKEIQSQNFEKYELHRNINSLNKQQLINLFIDKEYQINLIPLTLLKEKSRNI
IYEENIKMNMCACIRVIFDSIKGRCIYAASNMYKLDFICEYVGDLLTYNEAMKREEKYKR
NTKKGCFMFYFKYDNKTYCVDSTKESMVDAEIHNKKMKKKKILRSFARLVNHSKKKSNLI
PKVLKVENNPRLFFVASRDIKEGEELLIDYGERDKDIIKDNEWLKF

BLAST