GenomeNet

>pfa:PFD0190w K11428 histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43] | (RefSeq) SET domain protein, putative (A)
MKSMTLYHENFKNINSFLNSASVIWIEKEKLDSIIYIPLYTDIFQYVENFIKNTEKKEKK
NVLTKIYLLFDDDTYNIAVDISPLCNEHTNRIPLLIYESYHFWHLQFLFEKFKIKRQKLI
LNPFENLKDIINKNRTYDYVYMYTSIYNCANNNFERQSKGEKIIQNHNEEITQEINQKVI
TKYCTYRNNFSTHLSLLNYNFKDNNNLYNDSNIKNKEPNWCPLKINIENIQKKRFKKINK
NKKHKNSKILNNTNMVHTLNSYVIPSNHFEKDDTKNKNLCIISQKEGNLHFQPYNGELKK
MKPLVYEEYEIISTDNDSNTLECGKKHENYNTSYDNYMYCTTNRCGRSPRYEGSKKSYAE
NNSRVYNRPHRKRKEKKKKWYYYEDSSSNDKNYNNNKKDDEEEEEENNDDKEENNDDKEE
NNDDEEEENNNNNNNSNKCDSLLTLDESFNNKKRKTSTCSTYSYNHMKKYKVEELKTDEC
NYDENYYNNTNNNNCYPLKEIYNYKYSEQMCNKFKKERIHTYDTFENKKGEKKNSVKNRK
ILHSSILSLDSQKMNPFDPIHTFKNMFCKSEKENLDFNHSDMFHIYHHNDSMDKYVNKIL
KNIMNKEKSPLNCLSKNYQRIEALYNKKYKIFLMDNKQIINGKTHFKNNKNEYILSKYEK
EMGLYELFKKYIKRDVEKVHNEKGQPQKPSNQNIERIHNSTEKHILQIQKRQEHSCVTEL
VGMCNIKEQDIINVKSCDDDDIICLSDEKNYMQEENDVICIDDNNNNNIYNDNNYNDNNY
NDNIYNNNIYNDNNYNDNIYNDNNIIDRHNNGGVLFYAYKKEDTKVIKLKEGDSLYIKFF
NSSDDYDKVKILKQETILFILIYIMQNKETPTLSDICIFSPDLFWNICLYFKDNIMGVDP
SLVKIHKFLSTGKSEENGYHRYSSKRINYCEKRKKRKNREPMEIMKLKDNVEFLDKFLEN
VNERKLNKLKEIQSQNFEKYELHRNINSLNKQQLINLFIDKEYQINLIPLTLLKEKSRNI
IYEENIKMNMCACIRVIFDSIKGRCIYAASNMYKLDFICEYVGDLLTYNEAMKREEKYKR
NTKKGCFMFYFKYDNKTYCVDSTKESMVDAEIHNKKMKKKKILRSFARLVNHSKKKSNLI
PKVLKVENNPRLFFVASRDIKEGEELLIDYGERDKDIIKDNEWLKF

BLAST