GenomeNet

>pfa:PFD1060w U5 small nuclear ribonucleoprotein-specific protein, putative; K12854 pre-mRNA-splicing helicase BRR2 [EC:3.6.4.13] (A)
MAEEYEKFKRFEYRMNSNLVLQREGPISNTKEPTGESESLVGRLKYKMGDKVEYSNKNKK
NIMLVQDNKEMAINRNKRKDIFDDDKYNRRSNKKIRHKEKSVLNVNIEDIFLYKPTTKYT
EEIYTKLMSKIRFLLGDNTGDIINSACNEILYILKNEELNNEEKKKQVESELEIYINDDI
FIEINNLSKEIYDFNKQEEGEYVENDEGVAVIFEEDDDYFNIGRNITRGYINDHETMELQ
ELSDDNEEEDISEDDDGDDEEEDDEEADAEEADDEDGDDEDGDDEEGDDEYGENEDGDDN
NNNNNNNNNSVRRKKKKKGNQINHLKSYDKKNKKFENYLSLKNTNKNLYYDEENKNVQDN
DELNINVIDSHWLQRELNKIFPDPSLCLDKEKEVLNVLNIYDIQESENKLMHILKYENFH
IARVLIKNRWKIYYCTLLGQAQTEEEKEEIKKEMKKTEEGQDILDELCNFKNVRKNKQSE
FSKIIRKEADNLFGKKKINDYNKKGNMSDYTYIHDDDDNDDNNDDNNDDNNDDDNNDDDD
EEKEEGPKYYDEENVSDDDNYYESTKLYNSDSQGEDANKKININAKDVKNIKGVKEEDND
GGSGKEDNEPTQKSFYNNMKYKFIDLEKLETKEKNKDIFFNKEVILPPESKRIERKEYDE
IIISSMKDNKMDGMKRTKNNKMNYYTSPEEIKLIHINELPEWTHEVFSCVNITKLNPIQS
KVYDVAFNKYEENMLICAPTGSGKTNIALLCILNVINSYRLTSGNINRKDFKIVYISPMK
ALVNEQVQSFNLRLKCMNIKVSELTGDVNLSTKELDDSQIIVMTPEKFDVISRKWNEKIL
LHKIKLIIFDEIHLLNEMRGNVLESIIARINRYMDNTMVYDMGDVADGSSGGIRGKNKDA
NRYNNNDDKKNDDNNNDDKKNDDNNNDDKKNDDNNNDDDDNYNGGGVNSVRQNKYGENHI
SIRRKKIRLVGLSATLPNYEDVGIFLRAHIERGIFYFDHSFRPVQIEQHYIGIKEKKGIK
KYALMNELTYEKVLEEAGKNQILIFVHSRKETYRTSKLLIDRFMKSDNLSKFLIDKKISS
EILLSEKEHVINEELKEILPFGFGIHHAGLKRLDRKLVEDLFSDRHIQVLVCTSTLAWGI
NLPAHTVIIKGTSVYNINIGDFDELSSMDVLQMVGRSGRPQYDKSGKAIIITDHKNLQLY
LSLNNEQLFIESTLLHNIVNIINAEIVLKNIQNMDDAMNWLEHTYMYIRMLKCPSLYGVI
INSNDKIKGIEEFKDIIDMNNKTKKHNNNNNNNINGGNNNNNNNINGGNNNNNNNINGGN
NNNSNNVMDYMSILKTNYKYNKFMEKIKRRMYNILYSCFLILEKYDLIKYNKKLNTVSST
YIGKISSYYYVDYKSIDIYNKKLNKYTNEIDLLKIFTMSNEFKNIFIRDEEKTELSIIME
KLPIPVKESINIPYTKINILLQLYLSNIILNGYIINADMVYIHQNALRIFRSFFEISLKK
NSYNLIKLTLKFCKMIERRMWSTMTPLRQFGLLSTELIRIIEKKNITFKNYLTMNLNEYI
TIFKNKKIAKNIYKLVHHFPKLELNAYIQPINHKILKVDLNIAPDFIYNPKYHGYFMLFW
VFVFDISNESILHYDLFTLKKNYKNDILNQTQRYNNNGNNSNMYNPSDVLDDHVLTFFLP
INDNPFYIVKVISDKWLECEATINLYLKDLILPSQNFYSTQLLDLQPLPIHSIKYDKAHT
FFNNIRNLHYFNSIHTQIFSSIFENNGNVLIASSNSKHYLIPAELGMIKILKFLHCFYNF
INTYIKKEKDVYKIINDKKLADLLYNNNLIDLIKIVYIAPLDDVIIKTFKNWQAMKKTFD
LKMCILTGDIQIDMKLLQTHHIILSNPSNYDNISKKWRRKKILQTVSFYIFDHMELLDTV
QGGIMEILISRIRYISTQLNINKSEKKNQHNNDNNNNDNLIMSILNIDMIKMDNVEDDNN
KKNIIHNNNNNNSNSKKDDFVQTINALQNFTIDNIYDYIGLNRILCLSSCSLYNSKDFAE
WIGCKKNDYYNFLSTVRDIPIEIYLHAVNIMNKQNRYISMQRQVYQNIRKLKNIPKKKKM
QNVIIFVTDQKLCKTLALDLILSAYNDNFKYFSLFENYEDDKYDTSKSSTNPYDPKNEEK
EKKKGGGWISNLFTYNKDDKIGRHNESNDLINNNSHDDTTSNNLQKSGTFRSNDLYNNGT
NVEELAKSIHNMINLNISNMDIIKNKEVAENNMNVASSNNNNNNNSNSNNIYKNGRKRSN
NRNNKNEEHVFDYINDKMLRQFMKKGICYLHNNMTEIEKKIVEILFDKKTIQILIVSYDY
IYSLNVYANNVIILDTIITHFHNNKEEDYSIQNILEMISYAGRQNEDTKAFVYIYTYITK
KEYYKNFIYEPLTVESNIEDNLPNFLNNEIVMSTIENYQDAIDWLTWSFFYRRIKKNPNY
YGLKGISNEHISDYLSELIENNMEILSFANCINIEEQTMDIKPCNLGIISSFYNLDYHII
HFFNQYVLSLKTLKKSRIFEIICLSNIFNDILKIHNYDIFLCLKIAQACNNVQVTYEFLK
LSINNENTLKNANIEDNLNKDTKSEDYKKDQYINLLQFMSVPMYFTSHLKAFILLQAHIH
RYSLPLNYIQETKTVLLKAYKLINSLIDVISSNNILNFCLFVMEVSQMLTQSMKSTDQSN
LYQLPHFDEHLIKKANDLEILDVYDLINAEDEPRDILLKHLNEKQRSEIANVCNIFPIIE
VQYEIDLDKSYKVNEIAQLNLTIERDLTDDAVIFAHSLYLPFEKEEMWWIVIGIKKMNLL
LSIKKLSLLKSVNNIKINFELPDKPNTYDVVIYVINDCYVGCDQEYEFKINVEE

BLAST