GenomeNet

>pfa:PFL0630w K00235 succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1] | (RefSeq) iron-sulfur subunit of succinate dehydrogenase (A)
MLKKYELKGVMNILNKKLCNNKSRNDIIQAYTYIQKRFNNGSINKEFEMKKQVEQINKVN
GEVVKRKKKFSIFRYNPTNKKRPQMETFEVDIDNCGPMVLDVLIKIKDEIDSTLSFRRSC
REGICGSCAMNINGKNGLACLTEVNRDKKEITEIQPLPNLYVMKDLVPDLTNFYNQYKSI
DPWLKRKTKKEKGQKEFYQSIEDRKKLDGLYECIMCASCSTSCPSYWWNPEYYLGPATLM
QAYRWIVDSRDEYTKERLMEVNDTMKLYRCHGIMNCTMCCPKGLDPAKAIKDMKNLVQEN
FSEDTIKEHSQYIKSKMEKTK

BLAST