GenomeNet

>pfc:PflA506_1430 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) ligD_2; DNA ligase D (A)
MTDALNEYNKKRDFDATPEPSGAKKSTRKKKAEDHALQFCIQKHDASRLHYDFRIEIEGT
LKSWAVPKGPSLDPQVKRLAMEVEDHPLDYATFEGNIPEGHYGAGDVIVWDRGIWKCIGD
PVESYKKGKLKFELEGEKLGGLWNLVRTHQEGKSKPWFLIKHQDSAAKPEAEFDVVKELP
DSVLSDRTIIPKKRGKQPKAKAVEEVPEPRKRAKTGKLTGAKPAPMPDLIKPQLATLVET
APAGDWRYEIKFDGYRMMARIDNGEVKLFTRNGHDWTSKLPRQAEALASLALQSAWLDGE
VIAADDEGVPSFQILQNAFESGKSQAIVFYLFDMPYLNGVDLREVPVEERRAALAQVVER
SEDDIIRFSEDFGEEASDLLTSVCQMHMEGLIGKRAGSTYVSRRSDNWIKLKCKHRQEFV
VVGYSEPKGARTSFGALLLGLHDKDSGELRYSGKVGTGFNERTLRTILEQLKPLETSKPA
VVNPPTGADARGVHWLKPELLAEVAYAEITKDGSVRHSVFHGLRNDKPAKEITEETPVPA
SDVQGKKTKPAAKKKPVKADPKPTSGKIRITHLDRVIDASSGSTKMQLAEYYVSIADWIL
PTLHDRPIALVRAPEGIAGELFFQKNVERLPIPGIETVEGESVMLINNAEALVGAVQKST
IEFHSWNAKAPDLDRPDRFVLDLDPDPSLPWKSMVEATTLTLTILDELGLKSFVKTSGGK
GIHIVVPLTPKDDWETVKGFSQKIVQHMAKLIPDRFSAVSGPKNRVGKIFIDYLRNGKGA
TTINAYAARTREGLPVSVPLFKEEVKEIKGANIWNIHNLHERLGELGEDPWKDYGKIKQT
ITADMRRMIGLKK

BLAST