GenomeNet

>pfd:PFDG_02150 K00006 glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8] | (Broad) hypothetical protein similar to glycerol-3-phosphate dehydrogenase (A)
MLKFFILYFYLIFQAITCFSVNQINVGNKYSLIRNPQSNVPLKVSIIGSGNWGTVVSKII
GMNAQKLKIFHPIVKMYVKEEIVEEEKLSDIINKKKENIKYMKGMKIPENILAISNLKEV
IDDADLLIFVLPHQYLDNVLDEIVQNNNLKKNARAISLIKGIKMVRSKPQLLSDIIEKKL
DIECLALSGSNIAEELSREHFSESTIGFEKKGNEVIWQNLFDRTYFKVNCIQDKPGVEIC
GALKNVIALGVGFIDGLTASYNTKSAIIRIGLEEMKKFAKMFFPNVLDETFLDSCGLADL
ITTCLGGRNFKCAKEFAKRKGRDSWELIEAELLNGQKLQGIDTTKEVYDVLEYHQLKTEF
PLICTIYEISFQKKNPCSIIDVLSTKKLRNIKYK

BLAST