GenomeNet

>pfd:PFDG_03443 K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] | (Broad) hypothetical protein similar to phosphoenolpyruvate carboxylase (A)
MIEKKGCVDFIKPLKDDIKALDFLLFDMLKDNLPNNLFEILCTIHDLSETYSENPNDDNF
LSLKNCIYNLKDEYLGTIVNAFGHMCVISNFAEWAHRGRRRKAFDKSFIPNDKIYGSVNE
TLKGTFNILIQNGFQLNDIYGQLCNQTIEFVLTTHPTQAIRTSLLKNYIRLGELLLKLDN
TDKELYKKKLLYDNLKTNLLSSWKTDVIRRIKPTPIDEAISLVDIVENCIFYRIPNIIRY
IDNVLFEYNLPPVKLNSKLCIFSSWAGGDRDGNPFVLPETTKYVCYMNKIRGCELFIPMI
EILIRDLTLHHCTQHFRSYVKLLEDEVSDYIFDKDHKYLAKKFQWFSPFSKSNKKEIYRR
ALLVVWAKLKSVVEVYKSLISNQRVDEDFKKLMFHNSDEFEEILLECYKSLVESGNTLIA
EGYLKDVIRNVKIFGLHLMKLDIRQESEKHISTMNYICQKLNMKKYSLLNEEQKINFLTD
ILNSNRPLIPKNIEEEEDVPNDFINVIKTFDVCSQIEDSALGAYIVSMCTNASDILLVEV
FQKEMKKGTQRKTQRVVPLLETIQSLQNSSIILENLLKNPWYRKHLTTNFEDKQEIMIGY
SDSGKDGGRLTSAWELFKAQEKLVHIGKKYSVEIRFFHGRGGSVSRGGGPQHLAILSQPI
NTIKNYLRVTIQGEVITQDFCLKGMALRSVEIYMSALLKCSLLKNTLVIKKEWRDLMDEI
SEISTKEYRKVVYENKDFVKYFRCATPEIEIGKLNLGSRPSKRKEGNVESLRAIPWVFSW
TQNRMHLSVWLGIEKIYDYLINNNKLHIIQDMYTHWPFCTSFFNLISMVMAKASIQISQE
YDILVPEELKYIGVLLREKLKKSMELTFLVTNEKKFCDNDQLTKRSIECRTKWVTVCNLI
QIQALKRLREKESKQKNENKDQLDNKDNSSYTNITHNYKIYENTLVTPTSEYTNVENIKQ
DNNQLNNSMENHNINDLNTLKINYTENYNFNKQNELFNNDEGEHMESINKNSTVRINSYL
SRKKKKLIKNPKFHPLIELHPYVFPQSETENESFFDYVKTIDSNFERIPSRNNVSTYDEA
TNKFIDYTSLNDALIVSIKAIAAGMQNTG

BLAST