GenomeNet

>pfd:PFDG_03670 K02358 elongation factor Tu | (Broad) hypothetical protein (A)
MLKSKCIFLNSFTKSDKLKHTFERLNLMMEKRNMNNLLYNKAVECHIYIRRDRDTKETNK
KLNNMYNKYSCKCNITNKCSNKNKVYNIYKRQNNLVDNKDKFFCIFRQNFAIGIFERKKP
HMNIGTIGHVDHGKTTLTAAITKVCSDLNRGVFKSYEEIDKTPEEQKRGITINATHVEYE
TEKRHYSHIDCPGHLDYIKNMITGTSQMDGSILVVSAYDGLMPQTKEHVLLSRQIGIEKM
IVYLNKIDMCEDQELVDLVELEIRELLSFHKYDGDNIPFIKGSALKALNGDQSEYGVPSI
LKLLDACDNYIEEPKRKTDLPFLMSIDDVLQISGKGTVATGKVEQGTLKLNDQVEILGIK
EKSIKTVITGIEMFRKILDTAQAGDQIGIMLKNVKRNDITRGMVVTKATNIKTFKKFESD
IYVLKNEEGGRKNPFSSYYRPQAYIRTADVNCAVILNEDTQVANPGDNVKCVIELMYPLA
LTYGLRFSLREGGKTVASGVITKLL

BLAST