GenomeNet

>pfe:PSF113_1324 sodB; protein SodB (EC:1.15.1.1); K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] (A)
MAFELPPLPYPHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKTS
SGGIFNNAAQVWNHTFYWNCLAPNAGGQPTGALAEAINKAFGSFDKFKEEFSKTSIGTFG
SGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNVRPKYVEAFWN
LVNWKFVAEQFEGKAFTA

BLAST