GenomeNet

>pfe:PSF113_2169 icd; hypothetical protein; K00031 isocitrate dehydrogenase [EC:1.1.1.42] (A)
MGYQKIQVPAVGDKITVNADHSLNVPDNPIIPFIEGDGIGVDISPVMIKVVDAAVQKAYG
GKRKISWMEVYAGEKATQVYDQDTWLPQETLDAVKDYVVSIKGPLTTPVGGGIRSLNVAL
RQQLDLYVCLRPVRWFEGVPSPVKKPGDVDMTIFRENSEDIYAGIEWKAGSAEATKVIKF
LKEEMGVTKIRFDEDCGIGIKPVSKQGTQRLARKALQYVVDNDRESLTIVHKGNIMKFTE
GAFKEWAYEVAAEEFGATLLDGGPWMQFKNPKTGKNVVVKDAIADAMLQQILLRPAEYDV
IATLNLNGDYLSDALAAEVGGIGIAPGANLSDTVAMFEATHGTAPKYAGKDQVNPGSLIL
SAEMMLRHMGWTEAADLIIKGTNGAISAKTVTYDFERLMEGAKLVSSSGFGDALISHM

BLAST