GenomeNet

>pfe:PSF113_2933 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) ligD2; LigD (EC:1.11.1.9 6.5.1.1) (A)
MSRKTLDDYNRMRDFAATPEPAAKRSRKSARTAHALQFCIQKHDASRLHYDFRLELDGAL
KSWAVPKGPSLDPKAKRLAVHVEDHPLDYATFEGNIPEGHYGAGDVIVWDRGVWIPQDDP
HEAYEKGRLKFELQGEKLSGLWNLVRTHMPGKQEQWFLIKHQDQAARPESEYDVVQAEPN
SVLSDRTLVPKRRGKAATAKALKQPEKAVQAKSPRRAAKTTLSGAVAGPLPETLKPELAT
LVDSAPDGEWLYEIKFDGYRVMARIENGGVKLLTRNGHDWTHKLPRQAEALAALGLESAW
LDGEMVVANDQGVPDFQALQNAFEAGSSGKIAYYLFDMPYLNGMDLRKVPVQERRAALAA
VLEPNQSPLLRFSDAFEETPEALLNSACQMQMEGLIGKRIGSAYVSRRSNDWIKLKCKNR
QEFVVVGFSDPKGARSAFGALLLGLHDADSGQLRYAGKVGTGFNETTLKSIYQRLLPLER
KEPAVANPPTGYEAKGVHWLEPTLLAEVAFAEMTKDGSVRHAVFHGLRNDKPAKEITQEL
AKPMKKTAATKKTKAKDEPGATPAKTKSKAKAPALDGKVRITHPERVIDASSGTTKLQLA
EYYASVAEFILPELADRPAALVRAPDGIAGELFFQKNAERLAIPGITSLDKALTGQPVMI
INNAEALIGAVQMSTVELHTWNATSVDLDKPDRFVLDLDPDPALPWKSMVEATQLTLSVL
DELGLKAFLKTSGGKGIHVVVPLTRKLGWDEVKGFSHAIVSHMAKLLPDRFSAVSGPKNR
VGRIFIDYLRNGLGATTICAYAARTREGLPVSVPVFREEVAELKGANLWNVHNVHERLAQ
VGHEPWAGLKRTRQSITAEMRRRIGMRETDK

BLAST