GenomeNet

>pfe:PSF113_2933 ligD2; protein LigD (EC:1.11.1.9 6.5.1.1); K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MSRKTLDDYNRMRDFAATPEPAAKRSRKSARTAHALQFCIQKHDASRLHYDFRLELDGAL
KSWAVPKGPSLDPKAKRLAVHVEDHPLDYATFEGNIPEGHYGAGDVIVWDRGVWIPQDDP
HEAYEKGRLKFELQGEKLSGLWNLVRTHMPGKQEQWFLIKHQDQAARPESEYDVVQAEPN
SVLSDRTLVPKRRGKAATAKALKQPEKAVQAKSPRRAAKTTLSGAVAGPLPETLKPELAT
LVDSAPDGEWLYEIKFDGYRVMARIENGGVKLLTRNGHDWTHKLPRQAEALAALGLESAW
LDGEMVVANDQGVPDFQALQNAFEAGSSGKIAYYLFDMPYLNGMDLRKVPVQERRAALAA
VLEPNQSPLLRFSDAFEETPEALLNSACQMQMEGLIGKRIGSAYVSRRSNDWIKLKCKNR
QEFVVVGFSDPKGARSAFGALLLGLHDADSGQLRYAGKVGTGFNETTLKSIYQRLLPLER
KEPAVANPPTGYEAKGVHWLEPTLLAEVAFAEMTKDGSVRHAVFHGLRNDKPAKEITQEL
AKPMKKTAATKKTKAKDEPGATPAKTKSKAKAPALDGKVRITHPERVIDASSGTTKLQLA
EYYASVAEFILPELADRPAALVRAPDGIAGELFFQKNAERLAIPGITSLDKALTGQPVMI
INNAEALIGAVQMSTVELHTWNATSVDLDKPDRFVLDLDPDPALPWKSMVEATQLTLSVL
DELGLKAFLKTSGGKGIHVVVPLTRKLGWDEVKGFSHAIVSHMAKLLPDRFSAVSGPKNR
VGRIFIDYLRNGLGATTICAYAARTREGLPVSVPVFREEVAELKGANLWNVHNVHERLAQ
VGHEPWAGLKRTRQSITAEMRRRIGMRETDK

BLAST