GenomeNet

>pfe:PSF113_4240 sucA; protein SucA (EC:1.2.4.2 2.3.3.8 6.2.1.5); K00164 2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2] (A)
MQESVMQRMWNSAHLSGGNAAYVEELYELYLHDPNAVPEEWRTYFQKLPADGNSATDVSH
STIRDHFVLLAKNQRRAQPVSAGSVSSEHEKKQVEVLRLIQAYRMRGHQAAQLDPLGLWQ
RPAPADLSITHYGLTNADLDTTFRAGDLFIGKEEASLREIHEALQQTYCRTIGAEFTHIT
DSEQRQWFQQRLESVRGRPTYSADIKSHLLERVTAGEGLEKYLGTKYPGTKRFGLEGGES
LIPMLDELIQRSGSYGTKEIVIGMAHRGRLNVLVNTFGKNPRELFDEFEGKKKVELGSGD
VKYHQGFSSNVMTTGGEVHLAMAFNPSHLEIVSPVVEGSVRARQDRRNDPTGEKVLPISI
HGDAAFAGQGVVMETFQMSQTRGFKTGGTVHIVINNQVGFTISNPEDSRSTEYATDVAKM
IQAPILHVNGDDPEAVLFVTQLAIDYRMQYKRDVVIDLVCYRRRGHNEADEPSGTQPLMY
QQIAKQRTTRELYAERLTQGGVLDAARVQEKVDEYRNALDNGLHVVKSLVKEPNKELFVD
WRPYLGHAWTARHDTRFDLKTLQELSAKLLEIPEGFVVQRQVAKIYEDRQKMQAGGLPIN
WGYAETMAYATLAFEGHPIRITGQDVGRGTFSHRHAALHNQKDASTHIPLQHLYKGQPRF
DLYDSLLSEEAVLAFEYGYSTTEPNALVIWEAQFGDFANGAQVVVDQFITSGEHKWGRLC
GLTMLLPHGYEGQGPEHSSARLERYLQLCAEHNVQVCVPTTPAQIYHLLRRQVIRPLRKP
LIVLTPKSLLRHKLAISTLEDLAEGSFQTVISEIDTLDAAKVTRLVLCSGKVYYDLLEKR
RAEGREDIAIVRIEQLYPFPEEDLMEAIAPYTNLTHVVWCQEEPMNQGAWYSSQHHLRRS
IGNHNKALGLEYAGRDASAAPACGYASMHAEQQEKLLQDAFTV

BLAST