GenomeNet

>pfe:PSF113_5297 tufA; protein TufA; K02358 elongation factor Tu (A)
MAKEKFDRSLPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSAVVAFDKIDSAPEEKARG
ITINTAHVEYNSSIRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADMVDDAELLELVEMEVRDLLSTYDFPGDDTPIIIGSALMALN
GQDDNEMGTTAVKRLVETLDSYIPEPVRVIDKPFLMPIEDVFSISGRGTVVTGRIERGIV
KVQDPLEIVGLRDTTVTTCTGVEMFRKLLDEGRAGENCGVLLRGTKRDDVERGQVLVKPG
SVKPHTKFEAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGNCELPEGVEMVMPGDNI
KMVVTLIKTIAMEDGLRFAIREGGRTVGAGVVAKIIE

BLAST