GenomeNet

>pfh:PFHG_03607 hypothetical protein similar to phosphoenolpyruvate carboxylase; K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] (A)
MPNLGGKEDEKLKFLIEGKMIEKKGCVDFIKPLKDDIKALDFLLFDMLKDNLPNNLFEIL
CTIHDLSETYSENPNDDNFLSLKNCIYNLKDEYLGTIVNAFGHMCVISNFAEWAHRGRRR
KAFDKSFIPNDKIYGSVNETLKGTFNILIQNGFQLNDIYGQLCNQTIEFVLTTHPTQAIR
TSLLKNYIRLGELLLKLDNTDKELYKKKLLYDNLKTNLLSSWKTDVIRRIKPTPIDEAIS
LVDIVENCIFYRIPNIIRYIDNVLFEYNLPPVKLNSKLCIFSSWAGGDRDGNPFVLPETT
KYVCYMNKIRGCELFIPMIEILIRDLTLHHCTQHFRSYVKLLEDEVSEYIFDKDHKYLAK
KFQWFSPFSKSNKKEIYRRALLVVWAKLKSVVEVYKSLISNQRVDEDFKKLMFHNSDEFE
EILLECYKSLVESGNTLIAEGYLKDVIRNVKIFGLHLMKLDIRQESEKHISTMNYICQKL
NMKKYSLLNEEQKINFLTDILNSNRPLIPKNIEEEEDVPNDFINVIKTFDVCSQIEDSAL
GAYIVSMCTNASDILLVEVFQKEMKKGTQRKTQRVVPLLETIQSLQNSSIILENLLKNPW
YRKHLTTNFEDKQEIMIGYSDSGKDGGRLTSAWELFKAQEKLVHIGKKYSVEIRFFHGRG
GSVSRGGGPQHLAILSQPINTIKNYLRVTIQGEVITQDFCLKGMALRSVEIYMSALLKCS
LLKNTLVIKKEWRDLMDEISEISTKEYRKVVYENKDFVKYFRCATPEIEIGKLNLGSRPS
KRKEGNVESLRAIPWVFSWTQNRMHLSVWLGIEKIYDYLINNNKLHIIQDMYTHWPFCTS
FFNLISMVMAKASIQISQEYDILVPEELKYIGVLLREKLKKSMELTFLVTNEKKFCDNDQ
LTKRSIECRTKWVTVCNLIQIQALKRLREKESKQKNENKDQLDNKDNSSYTNITHNYKIY
ENTLVTPTSEYTNVENIKQDNNQLNNSMENHNINDLNTLKINSTENYNFNKQNELFNNDE
GKHMESINKNSTVRINSYLSRKKKKLIKNPKFHPLIELHPYVFPQSETENESFFDYVKTI
DSNFERIPSRNNVSTYDEATNKFIDYTSLNDALIVSIKAIAAGMQNTG

BLAST