GenomeNet

>pfv:Psefu_3554 glutathione S-transferase domain-containing protein; K04097 glutathione S-transferase [EC:2.5.1.18] (A)
MSLELVIGNKNYSSWSLRGWLLVELSGAAYQETLVPLFRADTHARLLEHSPTGKVPVLKT
EDAGVIWDSLAIAEYLAERFPEAGLWPRDVAARAMARSACAEMHSGFGALRSHMPMDMQR
NAPLASVTDEVKHDIQRIVALWAGCRERFGQGGPYLFGQLSIADAYFAPVASRLRSYGVQ
LPADAAAYVETIFQWPAFQRWHQAALEEKT

BLAST