GenomeNet

>pgi:PG1683 hypothetical protein; K07405 alpha-amylase [EC:3.2.1.1] (A)
MKHICLYFQIHQPFRLKRYRFFDIGNDHYYYDDFRNEEIMRRITQKCYLPANLLLKEIIA
EHPEFRVAFSISGTALEQLESYSPEALDTFRDLAETGCVEFLAETYAHSLSSLYDPEEFY
NQTMIHSRRMEELFGVKPRVLRNTELIFSDNIATQVAEMGFQGMLTEGAKHILGWKSPNY
LYKAGSAPELSLLLRNPRLSDAISAMFTRYDWNEYPLTADKMIRWIEETPEEEQIFNLFM
NYEVLGSLHPQESGIFDFFRALPSLAKKSEGVKFATPSELIESSSPVAKFSSIYPISWVG
EEKDTGTWLGNVLQQGACDKLEQWGERVRMIDDQRMLQDWLYLQSADHFYYMKTRGGDAG
NFSPYETPYDAFNNYMNVLSDFLLRVEARYPSTIENEELKALLTTIRNQDKQIKKLEETI
KRQKTKTT

BLAST