GenomeNet

>pgr:PGTG_01887 no KO assigned | (RefSeq) hypothetical protein (A)
MISKSEQKDLHLLTMSTPNGKKVQIALEELKLVYDDISFSHEMIDIRTNQQKSEEFLKVN
PNGRIPALIDNKCKALNDPSAPFTVMESAAILLYLAKKVDKNHVFGFEDDLERSEALQWL
FFGMAGVGPMQGQLNHFTRYAPEKLPYAMKRYHDETLRLYGVLEIQLSGKYTGVKKKYLA
GKGEGKYSWADMAIWPWVDIYTISGITDDEMNQFPCLMEWLKSIRERPGVKEGCSSKYDL
K

BLAST