GenomeNet

>pgr:PGTG_10848 succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial; K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] (A)
MLRSKATSLLSRVKPSPTPLANRTFSSSSSRSRIISTQPVKASETSAKFSNGKYPIIDHE
YDAIVVGAGGAGLRAAFGLAEAGLNTACITKLFPTRSHTVAAQGGVNAALGNMTEDDWRW
HMYDTVKGSDWLGDQDAIHYMCKEAPQAVIELEHFGVPFSRTKEGKIYQRAFGGQSLKYG
KGGQAYRCAAAADRTGHAILHTLYGQSLRHNTNFFVEFFALDLIMDDAGNCVGVTAYNQE
DGTLHRFRAHQTVLATGGYGRAYFSCTSAHTCSGDGNAMVTRAGLPLQDLEFVQFHPTGI
YGAGCLITEGSRGEGGYLLNSQGERFMERYAPTAKDLASRDVVSRSMTIEIREGRGVGPD
KDHCYLQLSHLPPEVLHERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGQ
VLTQDPKTGADKIVPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRACAKHISANMEPG
KPHKAMSEDAGMKSIEDLDKLRNASGPKPTAQIRNDMQRVMQNDAAVFRTQSSLEEGVQK
IHKVVDSFKDVGVTDRSMIWNTDLVETLELRNLLTCAAQTMSSAEARKESRGAHAREDFP
EREDDSWMKHTLSWHNPESGEPVKLTYRDVISSTLDENECKSVPPFKRTY

BLAST