GenomeNet

>pgr:PGTG_20898 K00693 glycogen synthase [EC:2.4.1.11] | (RefSeq) hypothetical protein (A)
MTARYTGEIGTEVPDPSTLLSSKDKILLKRRVFALKRNSLPPVVTHNMADDSADPILNQI
RRVQLFNGSHDCVKVIFHPDFLNSNNPILGLDYEEFYSLFAFLYSLSVSQTSSNPLVELR
THDTLRSSPSSMPRKALEKYNIIPPGRRGCTTSPARRESSWSTRLYNLAGQEGVLLFGEA
VQPRRPGGNPPGRRG

BLAST