GenomeNet

>pgr:PGTG_20898 hypothetical protein; K00693 glycogen(starch) synthase [EC:2.4.1.11] (A)
MTARYTGEIGTEVPDPSTLLSSKDKILLKRRVFALKRNSLPPVVTHNMADDSADPILNQI
RRVQLFNGSHDCVKVIFHPDFLNSNNPILGLDYEEFYSLFAFLYSLSVSQTSSNPLVELR
THDTLRSSPSSMPRKALEKYNIIPPGRRGCTTSPARRESSWSTRLYNLAGQEGVLLFGEA
VQPRRPGGNPPGRRG

BLAST