GenomeNet

>pgu:PGUG_00009 K01190 beta-galactosidase [EC:3.2.1.23] | (RefSeq) hypothetical protein (A)
MVNGTSIMLPLPNLLLLPSEDFTFEKKLVVPGHWQLQGYGSPQYTNVVYPFVVDVPNPPT
RNPTGTYHRQFTVPKTWELHQCRIRFEGVDNSYHVFLNGKLIGYHEGSRNCAEFDLEPAI
KRDQVNHLWVRVYQWSSSTYIEDQDQWWLSGIFRDVWLLGFHKQGHIENFVVTTDLKNTD
GVCGLKVQVGGENHSFQKFEGLKLYVNLLGSENLAEVNSSVTNLGIKVPNVKPWTAETPT
LHKLTLELRDSTGFVLSKVVQKVGFRKVEMSDGQIKVNGQPILLRGVNRHDHHPQFGRAV
PLDFIKRDLQLMKQHNINAVRTSHYPNTPQLYELANEYGFWVFAEADLECHGFFECVRRP
IDGSDDPEYKNGKLELFGRAKKFTSDNPEWKNTYVDRARGLVLRDINQPCIIVWSLGNEA
FFGQNHVAMADFIRHADPTRLVHYEPDMDATVTDMYSRMYPLFETMQEFIKKNDKPLVLC
EYAHAMGNGPGLLRQYQELFYTVPHFQGGFVWEWNNHGLETEANGLKFYGYGGDFGEKVH
DGVFCMDGLVDSRHEPTPGLLEYKKVIEPVEVRFHDGEIEFKNMFDFSDLDAYYATFRLV
EYELVFSEEILALRQLHFPSVPPHSSYSILFPCEIPSSSNTVILDVDVKTLNSSEAVPKD
HTVAFGQKVFKASTKTEFNKTISNVNVEETNHRITVRSKALEFQFNKITGCVEKYNQDKP
IIVAGLNNLTFWRPTTNNDDNFDGPYWKKFGLDMMEIQVRNVKVTPIANGERSNLLATLE
VESFIGPPILSWGFDCIQKYSIYADRLEIGTLLTAIGFNKCCVPLTLPRLGYEFAVPETV
NEILWLGRGSGESYADKKESQKIGLYKKKFGDSDYSYDYPQENGNHEDVTWLALKDGDGG
FVITMKNRNFGFKCSSEYDVQQALHPHEIKRGQKYVRVDYQQHGVGTAACGPGVLEKFQF
KLEGPIEFTTTIRYVES

BLAST