GenomeNet

>pgu:PGUG_00321 hypothetical protein; K11422 histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43] (A)
MSYRFKGPDRGDRGDRNDRGGGYHTNYDDKYRREVAPKLSNLYDSFRPSGPRKHNTNHYD
RDAYYRPMEHRNPSKPAQTPSTNPKPEFKPDHEQENGRHSHHGNVQNHTRSPLQPPTPNS
VTSAPEEVTGTDPRTGVNPHDLKVPTLQLHRDHLQLEFSSPSDPPKNYKVLYDPENDSHR
NKSTNKSKSKVFRFNGSSVSDPQSYSDAIIHSSDITDPRKKILSTYFSKPNKNSKKFPFK
QLPQPRFVFDKNSVGPPPQTELVVWDIPSTTSEVYVTNFFRSHGNATEINFLQDPMYAVP
LGVMLFRFQGSPDKSMLLAKNLLNFVHLEKPKINGVVLKIELNDHEGKLLRSKVEIAQNR
IRQSKQKLEMEEQKRREMEEEKKRKEIVAQREEARQKESQNNTFQKYDYKPNTTIMSVKY
RNKVIPGTFLPREVRHIIKDNPYLFIHDKHVSTRTVSAQDIKRVLNKYNWSRVLHEKVGF
FIIFNSLEECKRCFWKEDGRRFYEFRMFMEMAVPEGFEDKSTTSATKGDAVEEATNMLIQ
EFQAYLKKDIRERVIAPQVLELLNPERFPVLKAQLDEERTKQAQAAAARAETIASKIQET
RNKEGAYALMNKKAAQLPSFKRKEGIKMQAKKRVIPMQHVLNYENDSDDSEDDSSRSATP
APALKRERSLPATSYDEEAPSKKKKKTLLKTMLLYDSSEGEVSDSPEDQVMEDAEEAADQ
VDDFADVDVKFRPTLHSSVPVYPEDEFVDEFDVNYIQSSIKDEEDLNIAKSILSELKPST
IANVDYWAWKQKETRKPEEIAESVHLIEPLAPKFESASGSFRSEGYRKIPDTDKIEYLPH
RRKIYKPVKTVQHEDDETSANNGNGTNNSTAVHSSRVNRANNRRLVADISAQKQMLGSET
DILDLNALTKRKKPVTFARSAIHNWGLYALESIAAKEMIIEYVGESIRQQVAEHREKSYL
KTGIGSSYLFRIDENSVIDATKKGGIARFINHCCNPSCTAKIIKVEGKKRIVIYALRDIE
ANEELTYDYKFERETNDDERIRCLCGAPGCKGYLN

BLAST