GenomeNet

>pgu:PGUG_00965 K00844 hexokinase [EC:2.7.1.1] | (RefSeq) hypothetical protein (A)
MTISHDAHERSNLLKDVPQELSTELHAIEDMLTLLPEVLKKVTAHFITELDKGLSKKGGN
IPMIPGWVMDFPTGKEKGDYLAIDLGGTNLRVVLVKLDGNRSFQTIQSKYALPLDMRTST
ADELFGFIAKCLKEFVEQEFNDGCTEPLPLGFTFSYPATQYSINTGVLQRWTKGFDIDGV
EGHDVVPMLQDAIKNIGVPIDVVALINDTTGTLVASMYTDPETIMGLIFGTGCNGAYYDV
VKDIPKLEGKVESDVAQDGPMAINCEYGAFDNELVVLPRTKYDVLIDKQSPRPGQQSFEK
MISGYYLGEVLRLILLDLAEEKKLIFQGQDLSKLKEEFIMDTSFPARIEEDPYESLTEVE
ALFKEVLNLDTTFNERAVISRIAQKVGERSARLSVCGIAAICKKRGYKTGHCAADGSVYN
MYPGFKERTARALRDIFEWDDSVEDPITITAAVDGSGVGAAVIAALTEQRLKKGLSVGLK
K

BLAST