GenomeNet

>pgu:PGUG_01479 hypothetical protein; K13953 alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1] (A)
MLPSIQTAYTFKRGSREIVRRDDWPVPHPEDNQVLLKVEAVGLCMSDVHILMAQETHVPE
TFVMGHEIAGLIAAVGGKLELDPRYKVGNRFTVCIGLTCGRCANCRNGHDNCCTGNGKFP
GAYGLNRDGGFQQYLLVTDLNTLLPLPDGLSYEMAAVSSDSVLTPLHAVHKVKPDLVPTA
KILVMGLGGLGSNAVQIIKNYGCHVVACDVKPELEEFARQCGADEFYTDINSSPHKPELF
DVCFDFCGFQETFDSCQKYAQSGGKIVVVGLGRSKLMLRNYDSARRSLQVIFSFGGTASS
QEQLLQWVTKGLVKPMVTNGDFAELPQYLKRLAKGEVKGRVVFRPSKL

BLAST