GenomeNet

>pgu:PGUG_01858 hypothetical protein; K01580 glutamate decarboxylase [EC:4.1.1.15] (A)
MTLSKHFDVEEITHKLLNRTPKTTLSKDQHFLSAYDSNQVIPKFLIPENSTDAELVYKYL
LEELTLDGIPTLNLASFVTTTINDFPKRLAVENLTKNLADNDEYPSLIEFQNRCISILSN
LWHAPTTPHPETGVSVPTTIGAATTGSSEAIMLGGLALKKSWQLRQKAAGKSTENPNIIM
ASCAQVALEKFARYFDVEDRIVPISKESRHVIDVSKIKENIDENTIGIFVILGSTFNGAF
EPVEQIAKLLDEVEKEKGLDIKIHVDGALGAFVAPFLFPNLKWDFAVDRVVSINTSGHKF
GLTSAGLGWVIWRDAKQLPENLRFKLDYLGGVEETFGLNFSRPGFQVVHQYYNLLHLGRD
GYTKIFESCQQNARLLANVLEKSEYYDVVSEIHKKVDTKRQDELYTLKGTRSENEGYEPG
LPVIAFKLKDEIRKKYPELPQLIISLLLRNKGFIVPNYHFPANEQNVEILRVVVKESLSL
NLLDKLMTDIIESTELLLNACTTAREIVKHHGSEKEQHALIYEILLSIASGGVEDVKAAQ
HAAYDKEGTGHRKHKKSYRGAC

BLAST