GenomeNet

>pgv:SL003B_0101 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) Glutathione S-transferase family protein (A)
MYTVIGTPRSRANRVIWILEELGEPYDLVPALPQSEEIRALNPAGKVPALLVDGAVLTDS
VAIVQFLADRHGRFTFPAGTIERARQDSFTQFCVDEIEGALWTAAKNSLFHPEEIRVPAI
KDVCRMEFDTALKTLEARLGEGPYVMGAEFTVPDLLFGQCAGWAAAAKFDLPKEGALHAY
FKRLRERPAYRALMQKVAEAA

BLAST