GenomeNet

>pgv:SL003B_3229 K10747 DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7] | (GenBank) ATP dependent DNA ligase domain family protein (A)
MHAFARLLDRLSFEPRRTAKEALLVDYFRTTPDPDRGYALAALAGSLDFPHAKPALLKGL
VTERVDPVLFGLSYDFVGDLSETIALMWTAPAGRPDDGAEPLALRDVVSGLRGAGRTQAP
ALLSTWLDRLDEIGRWALLKLITGGLRVGVSARLAKTAVARLGRLEPDDIEEIWNGLATP
YAELFAWAEGRADRPRNVDPAPFRPPMLAHPVNEEKDFAALDAADFAAEWKWDGIRVQAA
AGREPGGMHGRRLYSRSGEDISAAFPDLLDHLGFDAAIDGELLVVRDGAVQPFSDLQKRL
NRKSAGARIIADYPVAIRAYDLLAVDGEDLRSLPFHARRTRLERFVAELASPRIDLSPLV
PFDGWAELATARHEPGRLLGEADAAAVEGVMLKRRAAPYLPGRPKGEWFKWKRDPFLIDA
VLMYAQRGHGKRSSFYSDYTFGVWRGAPDARELVPVGKAYFGFTDEELREIDRFVRANTQ
NRFGPVREVVHTPERGLVVEVAFEGLNRSGRHKSGLAMRFPRISRLRWDKIPAEADRIDT
LEALLSATRA

BLAST