GenomeNet

>pgv:SL003B_3229 ATP dependent DNA ligase family protein; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MHAFARLLDRLSFEPRRTAKEALLVDYFRTTPDPDRGYALAALAGSLDFPHAKPALLKGL
VTERVDPVLFGLSYDFVGDLSETIALMWTAPAGRPDDGAEPLALRDVVSGLRGAGRTQAP
ALLSTWLDRLDEIGRWALLKLITGGLRVGVSARLAKTAVARLGRLEPDDIEEIWNGLATP
YAELFAWAEGRADRPRNVDPAPFRPPMLAHPVNEEKDFAALDAADFAAEWKWDGIRVQAA
AGREPGGMHGRRLYSRSGEDISAAFPDLLDHLGFDAAIDGELLVVRDGAVQPFSDLQKRL
NRKSAGARIIADYPVAIRAYDLLAVDGEDLRSLPFHARRTRLERFVAELASPRIDLSPLV
PFDGWAELATARHEPGRLLGEADAAAVEGVMLKRRAAPYLPGRPKGEWFKWKRDPFLIDA
VLMYAQRGHGKRSSFYSDYTFGVWRGAPDARELVPVGKAYFGFTDEELREIDRFVRANTQ
NRFGPVREVVHTPERGLVVEVAFEGLNRSGRHKSGLAMRFPRISRLRWDKIPAEADRIDT
LEALLSATRA

BLAST