GenomeNet

>phe:Phep_2214 glycosyl hydrolase family protein (EC:3.2.1.18); K01186 sialidase-1 [EC:3.2.1.18] (A)
MKAIKRILNISILCCLLPVITVAQASQATQKKYKIPVLKGRANNPVLRIKIELNEAAELQ
QIDILTKGTLRLNDIQDVKLLASGTDSALFKAEKAGMLRLFAAANAPLKEKTSLTGNLPL
QKGINYLWLTLSLKATANAASFLNINATLVRLNKDSLKITPDNYANRLGIALRQHNQDQV
HTYRIPGLATANDGTLLGIYDVRRDSGRDLQGNIDIGLSRSLDKGKTWQPMQIVMDMGTW
GNLPEKFNGVSDANILVDKKTGHIFIAGLWMYGVINEQGKWLEGLTEQSKDWNHQWKTKG
SQPGFEPKQTAQFLIVKSTDHGKTWSKPVNLTKMCKQEDWWLWAPAPGQGITMKNGTLVF
PTQGRNASGKAFSNLTYSSDGGHTWKTSRAATQESTTENMVVELTDGTLMLNMRSNANSK
DTSSTNGRAIAITNNMGQDWTLHPTSHQALPEPTCMASIIRHDFVQNGKKRSVLLFSNPD
AKTARKNMTIKVSYDDGKTWSSDKKILLDEEKSRGYSCLTSIDNNTIGILYEGSQADMVF
QTIKLDELL

BLAST