GenomeNet

>phl:KKY_1733 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) ATP-dependent DNA ligase clustered with Ku protein, LigD (A)
MARARDLLKEYRAKRDFTKTSEPQGGKGASSGNVFVVQKHDATRLHYDFRLEYEGVLKSW
AVTRGPSTDPADKRLAVRTEDHPLDYATFEGKIPQGEYGGGTVMLWDFGTWEPVEDANKG
FKSGKLKIRLKGDRMKGDWALIRMKPKSGEKRENWLLIKEHDDFATEGGSKLLDKSTSVS
TGRKMSAIEKGEPPVRKSKTGGRSLPKFVEPQLATLVDSVPGGNDWLFEMKYDGYRCIAV
ISGEDVRLYTRNGLDWTDTFASLVAPMSLLTESSMLLDGEICAFDENGKTSFSTLKSHLS
EGGPLVYFAFDLLEIDGKSLRAKPLSERKAALENVLGRRTRHDPVQFSPDISGKGTEVFS
AICKAGHEGIIAKHGAAPYRSGRGKSWLKVKCTLRQEFVIVGWSPSEKRRGVFASLLLAT
QQDGKLVYRGRVGTGFPDDLRADLQAMLDKDARKTAPLTGVPRQMARGARWVSPRHLAEI
AYTELTPDGILRHPSFLGLREDKPAKGIGLEQPGKAEGGHTLSLTEDTGIAAAEKAGIKL
SSPDKVLYPGQGVTKGKLAAYYASVAEAMMPYIANRPLSLVRCPAGRAKQCFFQKHDTGG
FAQGMDTVQITEKDGKSDSYFTLDGLEGLLAGVQMGVLEFHIWGSRRDAIEKPDRIVFDI
DPDEGLVFGDVKSAALDIRGRLADLGLETFAMVTGGKGIHVIAPIARRAEWPAVKAFAAG
FAKQMAEDEPERFTATLSKKARKGKLFIDYLRNERGSTAIAPYSTRAREGAPVAVPVDWN
EVERLNAANRFSLEAAVERARDNAWPGYGKLRQSLPKSTK

BLAST