GenomeNet

>phl:KKY_1733 ATP-dependent DNA ligase clustered with Ku protein, LigD; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MARARDLLKEYRAKRDFTKTSEPQGGKGASSGNVFVVQKHDATRLHYDFRLEYEGVLKSW
AVTRGPSTDPADKRLAVRTEDHPLDYATFEGKIPQGEYGGGTVMLWDFGTWEPVEDANKG
FKSGKLKIRLKGDRMKGDWALIRMKPKSGEKRENWLLIKEHDDFATEGGSKLLDKSTSVS
TGRKMSAIEKGEPPVRKSKTGGRSLPKFVEPQLATLVDSVPGGNDWLFEMKYDGYRCIAV
ISGEDVRLYTRNGLDWTDTFASLVAPMSLLTESSMLLDGEICAFDENGKTSFSTLKSHLS
EGGPLVYFAFDLLEIDGKSLRAKPLSERKAALENVLGRRTRHDPVQFSPDISGKGTEVFS
AICKAGHEGIIAKHGAAPYRSGRGKSWLKVKCTLRQEFVIVGWSPSEKRRGVFASLLLAT
QQDGKLVYRGRVGTGFPDDLRADLQAMLDKDARKTAPLTGVPRQMARGARWVSPRHLAEI
AYTELTPDGILRHPSFLGLREDKPAKGIGLEQPGKAEGGHTLSLTEDTGIAAAEKAGIKL
SSPDKVLYPGQGVTKGKLAAYYASVAEAMMPYIANRPLSLVRCPAGRAKQCFFQKHDTGG
FAQGMDTVQITEKDGKSDSYFTLDGLEGLLAGVQMGVLEFHIWGSRRDAIEKPDRIVFDI
DPDEGLVFGDVKSAALDIRGRLADLGLETFAMVTGGKGIHVIAPIARRAEWPAVKAFAAG
FAKQMAEDEPERFTATLSKKARKGKLFIDYLRNERGSTAIAPYSTRAREGAPVAVPVDWN
EVERLNAANRFSLEAAVERARDNAWPGYGKLRQSLPKSTK

BLAST