GenomeNet

>pho:PH0016 K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] | (GenBank) PH0016; 475aa long hypothetical protein (A)
MRSKGVMIPRIMSTQHPDNYSIPFFASSPILGGEDEITEAFYAFSVLGADEQMWDFEGKE
VDEFVVKKLLERYPTFFKENILGEDLRLTPRVPNPSVEKAEAKLLLETLQGITRAADYAR
VFYLDNIAPIFEVILPMTTSLAEMLRVHELYRKIVSLSGEVIYDVTVKEWIGEFYPKEIN
VIPLFETKVALLKSGRIIREYIGRKRPEYLRVFFARSDPAMNYGLLSAVTYVKKALEQVG
EVEEETSTPIYPIIGVGSPPFRGGMRPENVKKVLKEYPSVQTYTIQSSFKYDHPTKDVVK
AVEIVKSKKREAPDPLDIPEFIQLYEIEYQKQLKILAPYIRNIVTRIPDRRKRKLHIGLF
GYSRNVGGLSLPRVIKFTASLYSIGLPPELLGLNELSDNQLDSISEYYKNLYDDLEFAMR
FFSFKVAERVGLRELSEKVKEFKPDIDDEYVREAELVFRGQGDVMKLAQIRGFLG

BLAST