GenomeNet

>phu:Phum_PHUM034490 Angiotensin-converting enzyme, putative (EC:3.4.15.1); K01283 peptidyl-dipeptidase A [EC:3.4.15.1] (A)
MFLLFLFLFAKFAFSQDTTNIEGNNESLEEALQFLREYDVEGSAICTRVTLAQWNFSTNV
STINRKKMVCYNKCGNDYGRTVMEQTLYDKFQKLSRRKATEFAWTKLPDPDVRRQMKKLI
TQGRFSLHDDQFNELKDVISQMKEIYTKGTICPYNKNPVYCDQKLEPTLTKIMAKSRDYH
ELLHVWKSWRDAVGPPIRQKYIRYVELANQAARLDGFNDAGDQMKSVYEIPNFEDHLSEL
WNMIEPFYKQLHAYVRRKLIKFYGSKYIRHDGPIPAHLLGNMWAQSWKNIEELIIPYPGK
TIGDITPELIRQVAEEFFISLGLKPMPPEFWRHSLLEKPIGREVVCRASAWDFCNKMDYR
IKQCTEVTMEDFLTIHHEMAHIEYYLQYADQPYLYREGANPAFHEAVGDVIVLSVQTPRH
LQRIGLLNNITDDYETNINYLLSMALEKVVYLPFAYIVDKWRWNVFAEGINNMNSKWWEL
KLNYQGLIPPVPRSESDFDAAAKYHVASDTPYIRYFLSVIIQFQLYESLCEASGHYGPLH
TCDIYRSREAGRLLREILQSGSSRSWSDVINVMTKGKIKKISASSLLNYFKPLLTWLEVQ
NKEELYVGWTTGPHDTGKIMDDVITRR

BLAST