GenomeNet

>phu:Phum_PHUM079870 mixed-lineage leukemia protein, mll, putative (EC:2.1.1.43); K09186 histone-lysine N-methyltransferase MLL1 [EC:2.1.1.43] (A)
MKISLEHEILLHPRYFGPQLLETVKQKLYAEVEGTCTGKYGFVIAVTLIDNIGAGLILPG
QGFVVYPVKYRAIVFRPFKGEVLDAVVTQVNKVGMFAEIGPLSCFISHHSIPADMQFCPN
FNPPCYKSKDEDVVIQADDEIRLKIVGTRVDASGIFAIGTLMDDYLGLVGLTSVVAKMAT
DRSLADRGIVEIKMGRSKFPGKPTKIGNRKRVNLSSCSLPEDNDSSTAAKNIYLGLSMFN
ETFGDNETITPGPFYGFSSNEIDEAMAEARLQQKEAEVAHKKQGIDINFWDSFQSELFSV
SSFTKHKLLPDNNCEKESKTIVSFDGGGLPFDFPFSHDNSDNEPSRTLNVNVVENNKVHK
INKKVRISSKLEKTSSKIKKLRAPRFKFNKNKLQCSPIANRSLQSQAAKKLLNKAKMTNL
LEINKNLPADKKFILPSRSTHSSRVIKPNKRFFEDNIIKKKYLNSQSCLNATVNNKQNLL
EESRKKFETRKLHWENKSSENLNLSESSNSSSSKFILREARLQLDKDKTQTSVLEGPFSS
PNLSSLCSNTQLKINLMQSTPGNKECAVCGIVIFCKFVEKPKEFGIFCCENCQKFIWKII
KSLESKKDFKLQCLKGNGLCEIVNIMKAQHFNVIESSYSTKCQACWLKLCLKNFKMPNKL
KQNLLKVLPVNMQINLSLDYGPTSSDTSSSKFRFSAKNMKHFKWFNENNSQEIRAVNKNN
IIDLPWSNISESNILNKKVLRKRTKNGENTVQSNIFLGQNEKIKSVNDKNRQSIVLKGPR
VKHVCRSASVALGQPLATFPTDLGSKKKKTNESSEDCNKCTTSPSPESNGVECQEVEFFS
ENVVDSKEEGKEKKLNTFKETTCNLKEVQVSRLNNGVKSKKKTNIKIENPVSMDFWESYD
PDEICETGFCLIGSEDFSVRALCFLCGSSGQEKLIHCASCCEPYHEFCIDEAQLKLQNNT
WKFDWVCPRCTVCFTCGKTSGQQLKCVKCDNSYHIECVDRVGGRLLHSPDRPWVCSICLR
CKSCNGVDVSVFVGNLPLCRACFVLRQKGNFCPLCQRCYNDDDYDSKMMECGQCKCWVHA
KCEGLSDEKYQVLSFLPESVEYVCRMCCVMPPAPWWIAVEAELKSGYLGVLKALSKNRKA
CTMLKWSPRKQCTCRPVEYTSRAFDLDVLNRTSKMLDVELEEISNSEKEINEKKKIHEEK
EMIEKYQPAILSERKTSIEVINHPTESLKLTLKIMKNCDTETENITESTTKDKSVKDIFD
DEKLQENSERVKNLIANQKFSDNSQSVNRKISPFEYNKVNSSNSGNTLDSDAGNSAKDRS
SIYDQNCFQLSSLETNKANGDISVNLLEGTRECVCFLDVESYNSRSKPFSPNLMSIKKKV
TTSEYSSLHQFHQDMERMIATSHSTELMDLYHQTIREIFPWFDPKFSKVQNSSQKVSSIK
SAESTPVKSTPKKIIPEEECKIPKYKLYDQPLDYFYSDYTVQDTRICVMCKVVGDGLPGH
TGRLLYCGQNEWVHCNCALWSGEVFEEIDGSLQNVHSAISRSRSIKCPECNLKGASIGCC
ARSCQETYHFSCAKKLGCAFMDDKTMYCLAHLKDVNNKLVQNEKEFEIRRPVYVELDKRK
MKTADSCQIRFVVGSLHVNNLGKFAGKLSDETKSIIPDQFSCTRLFWSCFEPWRIVRYHF
SVRLVEAENTQGVDTGINLTVDHSKDPELVELKLKQLKYFQENNSFLEINEKLVENQLGE
KRKLVELKAKCDKIKISDSNSPKKDKKNQKVVRKILDQYDFKDDENCLSDNQNTADLLPP
DVEEAIFKDLPHDILDGISMQDIFMDIKNYEYNSKENSEELYEGDDNLFNSLNKIHKKNE
NIQNESIWTESIDCKLEVIGETSLVSKSRNVKRNRTDDSLLLPSKKSTTLKTYQKSTNLN
RNYKCENFNNKWKKHSKCHVTVNLLEPQERGNMLQELKFTDGLVSITTGAIGSMKDLKSR
LEDNKRSIQEEGKENKFLAWQTRLQPRLLQVDGGVDSSSSGSEAGESPQRMTEESVTSKL
VDSSSQILDPLYSIKSSNVPEFQNFSTSENSHHSNKSSVSFSKGNTDSNSFILPQVDGVE
DCNSDVSDSEIQNCKKYSLKEIQNFNKVMVRKRDLINVFDLNYKIVQCDGGVDSECEEET
FKNCNLSDGSVYPLVAKVEEEPVKCGKCRCTYRTKISYQRHLESCTSDFILSSSEAEMSD
EESPKRHFNNISLKQKSDNINALAIPAKTTNKEHSKKNISYNSHLANDSLQISSHLNPIN
FEKPEVKKEKVKKTYTRRKVPTATKKNSPVNNKQQVQQILLQQQSAAAAPALIVQDVTGS
NLMSTAYIDSTPTLGYLAGIESQHFLNKTQLISTPGGVISGNFHVPSPSESQVLGGLCLN
TQNVQNNFPGFIIQQQPNIQGPVLSSQNSPVILSNEQLMVGSTDSYNVFQDPRTGGMFLT
SRNAPVFYNMETIVSNTVMQTNQFVSNVLGTTFSQTSTQIFQASEMEQIVNVPSNYILVN
SNHAGANRLFPSNDLLCVQTQPTFIQNQTPIQLGSSNQTVQPSQIFNPSIPTAQILNFDP
KTLPIQNNSFRCLQPVCPPIILGKVSNGLNNNVVNSTVPQVLQKTPASTPTIVNPVVTSK
SVPTIKPQQLNGFSSSQMTKLPVKIPEKPAIPLKSNPQSQIQSRSRALVDYINNFRSEAN
ETLLKSAQVQNKTKNNICDKSSSQSYNLNSSNKSINLNTCISTQQKVMQNQNNFHKSSSL
STELVNPSCKTEVKSTNNLKIPKSASSELLVTKAEIQSPASLKSEKIILPAKPLAANEPI
PSVKNFKIKNEKITSCTKTEESCPRRESSLISTSEETEKSPCAGVKIFQNLPPSNFEMQE
KEDGSTVPDSKNIEISMHEDSRPVKDEYPKQDNNTNHVLPLQENCQKINISPKNNNVKSS
PKGHSKDGENLFLKQEENYKIKRKINFLDQNSFDSKSLGINDKFESPPDKDASEVVADEN
ISFSKKSIEEKGPKLIFDVISDDGFKKSSSSMAELWANICDSVQEMRAMLKIPSLPLTKK
DYEILGMQNHGLQHCLEQLKGVENCVNYKFKYFTRDDSRRDSEDEVKENPSGCARTEKFT
NRKEYDMFAWLASKHRKLPKLTESAEETLCSIRRANNLPMAMKYRNLKETSKLYVGVYRS
QIHGRGLFCLREIEAGEMVIEYAGEVIRANLSDKREKYYTEKGIGCYMFRIDDHFVVDAT
MKGNAARFINHSCEPNCYSRVVDILGKKHIVIFALRKINIMEELTYDYKFPFEDEKISCH
CLSKKCKKYLN

BLAST