GenomeNet

>phu:Phum_PHUM244720 K06101 histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43] | (RefSeq) protein MLP1, putative (A)
MPHNKGGPCVRSDILASTAWNALIHHPVEDSDAEELPSTVDIDAIKGAPITGHTGHWNSL
NSNITKSNVEEKNESDSDDDKKISDSNSRSSSDSQSEDSESGSCSWSSSSESSSRSSSCS
SQSAVQSRISSPPSQTFSIRESNFEQSSSRSQTGTESDSCSSMKHEKFKLGQLYMDEKEK
MKKPTKVKSRLRFSGINDAKKKLHVDQGVDNKSLKETSMSSLKLTTSVTQISSTKKINKN
GESKSSVNVKSKNDNLKTFNCNKTEETSKSISMCEGPIIVGNKLNDSKSLSKKFNGKSII
NKKLDSSTIKRDLDINKCCSIVMPSNKKLSEASKLRCVRKNTGSQYNKPQSAIKPEAYSE
SSESENDCSKDEAAHYTALAQQLSHIGNSETLSSMSEHLQVINQEDLAAILPDVVTAENH
GSFDGFEDVSLECGKNEKKNVNQDSGSDVELPDQIVNDAIKRIHIDSEEMENSESEKGNQ
SSSDEDVEFRRGYSSSLLQQFVEKTEILSAQCERLINVSRSRKIASQNSLLMENILERRI
KRGRPPKIVKNSTSNNVESAQVVLGSVDRTNNKLMPELEAYRLDSSLSNVSPDSGIQSVP
GSPVNENIHVSPCRDVTPPILRPVTPVTGIPNKLSYLTKKSDISKKRPGRPKKIKLEVFR
NLLQNNNQSETKKDKNVKSEDRPPIHSLIPERRGPGRPKKAPPILEPNIPMVCRNELCKK
ETRNNINIVLNEICERVSRQLDFPSLSKESMRNVELNKEDIERILLHHKSKKSRNLKFDA
IFSKSMRLSNPPNVAIVKPMQHHRVEDNNVENDKLNKKSGKKCKNGNLDENTWYSVKLAC
EKLNIAEKEKDFTDKKSRSFMDEKLNKGNKCKKKTEGKSKTKDLGHKSVGFVSTPRTFPT
YKTLSTNDQLSKYFEKAKPNLQKKIHSLKKPRKNLKKSIKRKNGKTIHNLLHRKHKKCKR
SMKHLKCKQKKLDNEWFFKELEELITEFQKFSIGIVKKSISLVTGNNLCTMQTVNSVQNE
MGLPADFRVKRAVKKRKGSEKSRGSDRESGAEKSKLSDRESGPELPENEVLREKPKRKQK
KNHVEVINQGADTNSNEQRLPLKKRHYHLTSASNQQLLPSWTSDSTQSIVKSINADKPIN
KEVNSHLKKEAVEKIKCADSQKIQRNSIDEAIEATITRYTTKSCNVSPETNSDSNSTQSQ
FNNQQCVITTPKKRHRVPDLVAKTVFQSNICKNNNDVKSILKNSDINVKTMLSLRHGAGN
YTKVEPSCVQNLIKTSNFIKETNNKLFLPIESKKKTGIKNISKDIKGDKYVTGSTKGDIE
KSDNDEIFTRNNDKIKKYGLKNSEHSEHLHFSKTSEERLKKYEFKNVLFEKTLSKTSQKQ
HYTRSSSKTDMTPSDQTQSNNSKEVHLCKFNGSKESNENDHDDDKISEKLPEIEIFDSSL
DAKYDGKTLSPTVNLQNENDKNSSNLKKYRDGRILQSVEEKRKDKSHKKLFTQKKGIRKS
NYFKKPRCLKSCKEVRVNVKESTPKDILITKGVVEKKKVKRRKAINRTGFPSNKKKKKKM
SIKLDEIEDKTASEMTKFSNPDGSATKLQECETDKFSEDSNNKKNNLNLSTNTTDLNKSL
DCPTNESVKTDDDENNLENNRGNQISLEETTVQDSITEERESKVEGKVSESSGTKRVRKN
SSSLSDLVAKKVKTIKTENEEPKVKNNADLHKGIETTTGTISTRKRKSLNTTKNINFGLN
RYQYPLLSMKKFKRAKEELRAQSEESICDSVEEEVSKIKKSHPRWRKKYLAAGLFSDFYK
QDPPQKVNKVNEKSLSKLVYLLADQELDLLPPPSYCNKYVRLRRVDYQLPFDLWWLHTHS
QLPGRDIVPSWNYKKIRTNIYYDVKPQMTGTYEAQACNCTVPLNTKQKGCGEECINRMVF
AECSPQLCPCKEKCSNQRIQKHEFAPGLQKFMTKNKGWGIRTKQPIKAGDFILEYVGEVV
SDKEFKDRMASIYVNDKHHYCLHLDGGLVIDGHRMGGDGRFVNHSCNPNCEMQKWSVNGL
FRMALFALRNIPAHQELTYDYNFSLFNPAEGQPCYCGTNECRGVIGGKSQRIPLGNGQNV
VTSEKKEKKMVGRPRKTGKAKKHNVRDKNKIETVTVKPSTKPMSHQQRCFVQMHHCFLLR
NVDKVKRNKNNSKWNWKQSNNEVQSFSRQLPEIKQSDVFYTQLNALSTLRSIKTRRLAQA
EDNPELTKVAKLAYIFKDLYSAVISAKDEKGELLSAPFTNLPPKRKLPAYYQRVSDPIDL
ITIEQNINTGNYKTIEAFDQDMTKLFNNNVKFYGRTSELGIASTRLRRVYCLAKYDSASE
LEKVLGDAIPSSFIPENANPGDEEEDVIRCICGLYKDEGVMIQCERCLVWQHCDCVKADD
SVEHYLCERCDPREVNLEILIDPQPEYATEDTTHYISLLRGDLQLRIGDAVYVLRDMIEE
NTPKTSPPTKVTYKTIQNVNYADLDIFRIERLWIDKKGDKFAFGHHYLRPHETYHEPTRK
FFHNEVMRVPLYEVVPLDLIMNHCWVLDLNTYCKGRPIGAPEEHIYICEYRVDKSAHLFA
KIAKPYLICTKTYAFEKFDVRLKPTRTYTVHEAKSESLKQSESDEELPLAKIKENVHAAK
RDEQKKRLNSILLKLLSRLPNKQPLDLSYLLEPVKRFRGKAQQQGKRT

BLAST