GenomeNet

>phu:Phum_PHUM616180 Arginine kinase, putative (EC:2.7.3.3); K00933 creatine kinase [EC:2.7.3.2] (A)
MVEPAVLEKLEAAWKKLCATESKSLLKKYLTQEIFDKLKTKKTSFNSSLLDVIQSGVENP
DSGVGIYAPDAESYSVFADLFDPIIEDYHGGFKKTDKHPPKDWGDVNSLGNLDPTSEFVI
STRVRCGRSMEGYPFNPCLTEAQYKEMEEKVSSTLSALTGELKGSFYPLTGMSKEVQQKL
IDDHFLFKEGDRFLQAANACRFWPTGRGIYHNDDKTFLVWCNEEDHLRLISMQPGGDLGA
VYRRLVSAVNDVEKRIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANRAKLEEVA
GKFNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYEAVKEMHDGIAELIKIERELK

BLAST