GenomeNet

>pic:PICST_3402 K01186 sialidase-1 [EC:3.2.1.18] | (RefSeq) HYR6.2; hyphally regulated cell wall protein (A)
MLLFRSLVRVFLFATVALAFTVQKPKVDRGSINLSIGDITIQSGSFWSIFDNTVSIFKGD
LWVQKNAGFFITSTNKLIGLKVELASGFGSIRNDGLIVFNSLVSITPSFYKLIGKSFLNS
GEIFLVSSGYGVPTAALLAPIWKNTGSLTFFQNKRNNGVVSLGAPGLKIENWGQICLFNE
LYKQTTHIFGDGCITADQDSSIFFSNCLLDIDSRQTVYLADSRSSVRAVALAKPKTFKVA
GFGNGNKIGLDLPLISPFSKSVIYNAKTGILSLRVKGFWGQDFNIGLGYNSNKFKITTDN
SLGLLSVPWGAVYYDGPVPNKQIPSNCQPCKPYPSPPTTTTTKTNAQTTKTSTWTGTFTT
TVTETDTPGGTDTVIVEVPSTPNSQTTLTSTWTGTFTTTVTETDTPGGT

BLAST