GenomeNet

>pic:PICST_56005 K10747 DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7] | (RefSeq) hypothetical protein (A)
MAPRQQSIGRFFGSAMSVDSLLSQTVNKSPKNQKSESLTDEQNKREAFQVSQQESEKDQE
QKPDTDPSESEPEKDKTEEIKEASELIKLSEKEHEKHVGEKLSAKIPYSKLTDVLDKIEA
ESSRLKITAIVSEFFLEILKQSTVDKLVKIVYLFINRLGPDYEPDLELGLGETILIKAIS
ECYGRPSTKIKKDYQEVGDLGLVAQKSRSGQPTMFKPAPLDVDQVFENLTKIAKSTGKDS
QAKKISLINKMLTACNAKSSEAKFLIRSLEGKLRIGLAEKTVLIGLAQAFVNYEAKDSKR
INPEKLTQSEDVVREAFSQIPNYEILIRNAYEYGIFNLLDHCQLTPGIPLKPMLAKPTKS
ISEVLDRFQGEEFTCEYKYDGERAQVHLLHDGTVRIYSRNSEDMSERYPDLISIMKDFIK
TQEGQAPSMILDCEAVAWDRVANKILPFQVLSTRKRKDVDEKDITVHICLFAFDILYFDN
EPLITKSLKERRQVMEENLTPMDGKFQFATAKNSSNLDELQQFLDQSVKDSCEGLMVKML
NGKESYYEPSKRSRNWLKLKKDYLAGVGDSLDLVVIGAYIGRGKRTGNYGGFLLASYNQD
TGEYETTCKIGTGFSDEDLASLHTKLKPTEISVPKPYYVYDTTNSNAKPDVWFEPTTIFE
VLTADLSLSPIYKAAHQEYGKGISLRFPRFLRIRDDKGIEDATSSTQVSEFYERQASVN

BLAST