GenomeNet

>pic:PICST_61722 HYR6.4; hyphally regulated cell wall protein (EC:3.2.1.18); K01186 sialidase-1 [EC:3.2.1.18] (A)
MLFLKLLVRTLACVAAVLAIDITSPRIDRGVVNLSIGDITIESGAYWSIVDNAVSVLAGD
LDVKDDAGFYITSTQSLIGLSVTLASGLGSITNDGIIAFNSVVSLVAPNYNLIGLSFTNN
GEMYLGTNGSVVGAPPINLVAPSWTNTGLLVIYSQTRSADGIVNLGGTGLVIQNNGQICL
TNELYQASTQIRGTGCITANVDSTVFLANGLLGVDQSQTFYLADSRSSIRANAVAVPQTF
TIAGFGNGNIIGLDIPLATVFPLSSWSYTSSTGILTLRGLGLLSQNFNIGPGYNSNLFSI
TTDSSLGLASVPLGGLTYSGPVPNAIPSNCQPCKNLPSAPGTSASVTSTSFTSTKSDGSI
CTDVDQILISTDAQGSWFTSTSLVSEVCSTIPNSQTTETSTWTGTTTK

BLAST