GenomeNet

>pic:PICST_71431 hypothetical protein; K11407 histone deacetylase 6 [EC:3.5.1.98] (A)
MSEEPTGVAPESAPKKRLLEDADTDTKSTSNTSVSGTVENSTDINFHPDTNSTEASKGNP
DQIPVSNGDDHKRIKLEPKVGNESSIVVVPPTKPQLFYSPLKTGLVYDVRMRYHAKIFTS
YFEYIDPHPEDPRRIYRIYKKLAEAGLIVDSSLSGVEDIGPLMVKIPIREATAEEILEVH
SESHLKFIQSTETMSRERLLEETEKGDSIYVNNDSYFSAKLSCGGTIEACKAVIEGRVKN
SLAIVRPPGHHAEPETPGGFCLFSNVAVAAKNILKAYPESVRKIVIVDWDIHHGNGTQKS
FYDDPRVLYISLHRYENGRFYPGTKYGGADQVGEKDGEGYNLNIPWRNPGMHDGDYIYAF
NRVVLPVILEFDPDLIIVSSGFDAADGDIIGGCHVTPAGYGYMTHLLKGIAKGKLAVILE
GGYNLDSISKSALGVAKVLVGEPPEATVSMQPHLETIEVIDEVVKVQSRYWKSLRYGVPT
TSFDDVYDLNGTGSNYQLLNIGEPIRANQVNELFNKYSFVNLPIISSATEGGEKNGIFST
DLPSHLDDIIIASPDIYESTVVVLTIHDPPEIWANINPINGSIEGNSSVILEHPLMQIME
KMKKETDKSDSKEKIGYIDINVPSYQLPIPFGNSKQTSTYNPTFFAQELLLYIWDNYLAY
FSQLKKLVFVGFGDSYQAIVHLYGKRPSQDIKDLVKGTVAFVNRSNLKALVPVMDESMVD
WYYQNSVIFTSCSNPCWVNSNGTTRLGNGSTEANGGDDSNKRPRRKFGRVLKASVDGLYD
IIAERFDEGVDFILDSIEEYSSSESSN

BLAST