GenomeNet

>pif:PITG_00458 K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12] | (RefSeq) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, putative (A)
MLRTAFRLRTALPVQRRVAACVSRRFSSYPDHEVIGLPSLSPTMETGNMSKWNLKEGDAI
SAGDIVCEIETDKAVVDYEATDDMFLAKILIPEGAENIPVGQPMMVIVDEEESIAAFKDF
KLEEAPAAPTAPALSAEEKPPQKEDVPVDAKTHEPVLPQDFLVTSQTTKKTVPGPFIPAS
PAAKAAAPKAAPAPTSSAVFEEKWGLGIKKSAISTSLVKKQQAYIALYGITGKTPAVLIE
KKK

BLAST