GenomeNet

>pif:PITG_12827 K00799 glutathione S-transferase [EC:2.5.1.18] | (RefSeq) sporulation induced hypothetical protein (A)
MIVNGSVKVYVACTSVLYIKFLTATMIQGARKYATGARPPEDTWLPSSKRKQTFGIDNTN
DTKTLEAEKRWEGIVTNDLESIPLGLFIFGAGIMAGGNSKVHFRAMLAFTAARCLHTYAF
AYAKQPMRSLCQGVGVVATLVGLGNAVSAIL

BLAST